PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_16732_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 742aa    MW: 82569.4 Da    PI: 7.8868
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_16732_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-095495812254
                                           SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           ++yp+ +++  LA+++gLt +qV++WF N R +
  cra_locus_16732_iso_1_len_2617_ver_3 549 HPYPTDADKHMLATQTGLTRNQVSNWFINARVR 581
                                           89*****************************87 PP

2BELL113.11.5e-36398466472
                                  BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                           e  +kkakLl +++eV++rYk+y++q+q+v+ssFe+vagl sa+pY+slAlk +SrhFrcL++ai++q+
  cra_locus_16732_iso_1_len_2617_ver_3 398 EYLQKKAKLLYMQDEVCRRYKHYHQQMQMVVSSFETVAGLSSATPYISLALKSVSRHFRCLRNAISDQL 466
                                           6668**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-55322464IPR006563POX domain
PfamPF075269.0E-44327463IPR006563POX domain
PROSITE profilePS5007111.774522585IPR001356Homeobox domain
CDDcd000861.62E-10525586No hitNo description
SMARTSM003893.4E-9525589IPR001356Homeobox domain
SuperFamilySSF466895.13E-17527591IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-28528589IPR009057Homeodomain-like
PfamPF059203.7E-18542581IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
METRNLRPEL HVAQQSRRDK LRVHQQQNMQ IYSNHLQQHD DFPGGQEEAV LSPDLIQMRN  60
LRSYDLSYEP NVFSSSEMLH FAANSPHLVH QVSRTRERVD SSFTNLLSHN INSSSGGGDG  120
GKVSGWKNVG SQQQQNCEWV STNSNNPVFV PQGLSTNSLT GPISTDDEIP TSQKQYGDNN  180
MHNFYHSSWP NNSGNELLLL PTAYANFSDN KDYSSGGRII ANNESLSLSL SAVPSSNKEH  240
ERERQRRDRN IVSEEMNNSE TGGCFNSSSV LDTKPMKSEY NSCLINAKHS HHGVKGGIEN  300
VDMVGNSGFT PRCAAGPLGP FTGYATILKS SKFLRPTQQL LDEICNIFTQ KSVNVVLDDS  360
DNKVSNEIRP SRDGGNYGGD SAGVSSSSFS PNNSSRPEYL QKKAKLLYMQ DEVCRRYKHY  420
HQQMQMVVSS FETVAGLSSA TPYISLALKS VSRHFRCLRN AISDQLRNVR KAMGEELSSL  480
TTGTSSSKGG DTSSSKQKLM DQAFQKQKAV SGGDPRFFEP QQHVWRPQRG LPERAVAILR  540
AWLFDHFLHP YPTDADKHML ATQTGLTRNQ VSNWFINARV RVWKPMVEEI HTLETKGTAE  600
TGSSSAVKTE GKPPTEGVSQ SNGSRALNRL STSGTFSDKQ AECSEIGSSI GFTSNRMNNA  660
ETWNHHERQS RLDQCRIPGT TMDGSFMGFM PYQQSGIDMG GSLGLTLGLR QNAEGLQQHP  720
LQQQENQLRR HFGDHIIYDF VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-16531588158Homeobox protein Meis1
4xrs_A4e-16531588158Homeobox protein Meis1
3k2a_B5e-16531589563Homeobox protein Meis2
3k2a_A5e-16531589563Homeobox protein Meis2
5bng_A6e-16531589159Homeobox protein Meis2
5bng_B6e-16531589159Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243248RQRRDR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UHG50.0A0A068UHG5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000208251e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227